SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006221 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006221
Domain Number 1 Region: 307-372
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000565
Family VWC domain 0.0081
Further Details:      
 
Domain Number 2 Region: 480-549
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000711
Family VWC domain 0.0052
Further Details:      
 
Domain Number 3 Region: 1143-1204
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000732
Family VWC domain 0.011
Further Details:      
 
Domain Number 4 Region: 596-665
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000167
Family VWC domain 0.0084
Further Details:      
 
Domain Number 5 Region: 777-845
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000022
Family VWC domain 0.009
Further Details:      
 
Domain Number 6 Region: 195-253
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000272
Family VWC domain 0.026
Further Details:      
 
Domain Number 7 Region: 132-193
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000136
Family VWC domain 0.0051
Further Details:      
 
Domain Number 8 Region: 256-314
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000303
Family VWC domain 0.031
Further Details:      
 
Domain Number 9 Region: 365-432
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000199
Family VWC domain 0.064
Further Details:      
 
Domain Number 10 Region: 1005-1080
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000126
Family VWC domain 0.011
Further Details:      
 
Domain Number 11 Region: 947-1012
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000023
Family VWC domain 0.0089
Further Details:      
 
Domain Number 12 Region: 720-773
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000356
Family VWC domain 0.063
Further Details:      
 
Domain Number 13 Region: 1473-1538
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000589
Family ATI-like 0.05
Further Details:      
 
Domain Number 14 Region: 545-600
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000091
Family VWC domain 0.031
Further Details:      
 
Domain Number 15 Region: 1094-1139
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000408
Family VWC domain 0.0056
Further Details:      
 
Domain Number 16 Region: 680-726
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000126
Family VWC domain 0.009
Further Details:      
 
Domain Number 17 Region: 88-128
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000241
Family VWC domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006221   Gene: ENSGGOG00000015103   Transcript: ENSGGOT00000006390
Sequence length 1545
Comment pep:known_by_projection chromosome:gorGor3.1:7:127010751:127043676:-1 gene:ENSGGOG00000015103 transcript:ENSGGOT00000006390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGAAALSLLLHLGGLALAAGTEGGAVPREPPGQQTPAHSSALAGNSQEQWHHLREWL
GRLEAAVMELREQNKDLQTRVRQLESCECHPASPQCWGLGRAWPEGARWEPDACTACVCQ
DGAAHCGPQAHLPHCRGCSQNGQTYGNGETFSPDACTTCRCLAGAMQCQGPSCSELNCLE
SCTPPGECCLICQPGCEYEGQLYEEGGTFLSSSNPCLQCTCLRSRVHCMALKCPPSPCPE
PVLRPGHCCPTCQVLGCTEGGSHWEHGQEWTTPGDPCRICRCLEGHIQCRQRECASLCPY
PARPLPGTCCPVCDGCFLNGREHRSGEPVGSGDPCSHCRCANGSVQCEPLPCPPVPCRHP
GKIPGQCCPVCDGCEYQGHQYQSQETFRLQERGLCVRCSCQAGEVSCEEQECPVTPCALP
ASGLQLCPGVCEGGGVAAMGAASEGCRRRVLLPRMGYGLLSPLAILQSPAPCQHPTQPPG
ACCPSCDSCTYHSQVYANGQNFTDADSPCHACHCQDGTVTCSLVDCPPTTCARPQSGPGQ
CCPRCPDCILEEEVFVDGESFSHPRDPCQECRCQEGHAHCQPRACPRAPCAHPLPGTCCP
NDCSGCAFGGKEYPSGADFPHPSDPCRLCRCLSGNVQCLARRCAPLPCPEPVLLPGECCP
QCPGVPSEACSWAPLMRSLAHQEYFSPPGDPCRRCLCLDGSVSCQRLPCPPAPCAHPRQG
PCCPSCDGCLYQRKEFASGERFPSPTAACHLCLCWEGSVSCEPKACAPALCPFPARGDCC
PDCDGCEYLGESYLSNQEFPDPREPCNLCTCLGGFVTCGRRPCEPPGCSHPLIPSGHCCP
TCQGTATPALPFPLLGLPGCLSHRFHFPPSPPTACRSTILFSHSPTPSPLIEVLEPQNCH
SISRSHSPGPHAFMTQLLHARSVAGAGCTGQCLLPGAWSYLNLRARPCPLCTTGCLAHGE
EHPEGSRWVPPDSACSSCVCHEGVVTCARIQCISSCAQPRQGPHDCCPQCSDCEHEGRKY
EPGESFQPGADPCEVCICEPQPEGPPSLRCHRRQCPSLVGCPPSQLLPPGPQHCCPTCAE
ALSNCSEGLLGSELAPPDPCYMCQCQDLTWLCIHQACPELSCPLSERHTPPGSCCPVCRA
PTQSCVHQGREVASGERWTVDTCTSCSCMAGTVHCQSQRCSPLSCGPDKAPALSPGSCCP
RCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGGDFSVHVTNDDRGRSGVAW
TQEVAVLLGDVAVRLLQNGAVTVDGHPVALPFLREPLLYVELRGHTVILHAQPGLQVLWD
GQSQVEVSIPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPTDAAFGNSWQVSEGLRPGQ
PCSAGQEVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDLCACGPG
SSADACLCDALEAYASHCRQAGVTPTWRGPTLCVVGCPLERGFVFDECGPPCPRTCFNQH
IPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEACPQVLLTGD
Download sequence
Identical sequences ENSGGOP00000014744 ENSGGOP00000006221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]