SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006261 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006261
Domain Number 1 Region: 39-382
Classification Level Classification E-value
Superfamily L domain-like 1.28e-64
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 425-514
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-17
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006261
Domain Number - Region: 530-615
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00254
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006261   Gene: ENSGGOG00000006404   Transcript: ENSGGOT00000006430
Sequence length 713
Comment pep:known_by_projection chromosome:gorGor3.1:1:184645033:184713735:-1 gene:ENSGGOG00000006404 transcript:ENSGGOT00000006430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLVAPLLLAWVAGATAAVPVVPWHVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFL
TAVPPALPAGTQTLLLQSNSIVHVDQSELGYLANLTELDLSQNSFSDARDCDFHALPQLL
SLHLEENQLTRLEDHSFAGLASLQELYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAI
DSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMNLREISDYALEGLQSLE
SLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
IDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPN
LQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRLPVREVPFREMTDHC
LPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVSPAGLRLTPAHAGRRYRVYPEG
TLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEGQGLELRVQETHPYH
ILLSWVTPPNTVSTNLTWSSASSLRGQGATALARLPRGTHSYNITRLLQATEYWACLQVA
FADAHTQLACVWARTKEATSCHRALGDRPGLIAILALAVLLLAAGLAAHLGTGQPRKGVG
GRRPLPPAWAFWGWSAPSVRVVSAPLVLPWNPGKKLPRSSEGKTLSPPLSQNS
Download sequence
Identical sequences G3QU65
XP_004028278.1.27298 XP_004028281.1.27298 XP_004028282.1.27298 ENSGGOP00000006261 ENSGGOP00000006261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]