SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006321 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006321
Domain Number 1 Region: 119-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-23
Family I set domains 0.00036
Further Details:      
 
Domain Number 2 Region: 27-117
Classification Level Classification E-value
Superfamily Immunoglobulin 2.17e-18
Family I set domains 0.0052
Further Details:      
 
Domain Number 3 Region: 221-305
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000277
Family I set domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006321   Gene: ENSGGOG00000006465   Transcript: ENSGGOT00000006490
Sequence length 347
Comment pep:known_by_projection chromosome:gorGor3.1:19:52011243:52022249:1 gene:ENSGGOG00000006465 transcript:ENSGGOT00000006490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKLITVLCLGFCLNQKICTHVGAQDKFSLSAWPSPVVPLGGRVTLSCHSHLRFVIWTI
FQTTGTRSHELHTGLSNNITISPVTPGHAGTYRCAGIYKHTSKWSAESNSLKIIVTGLFT
KPSISAHPSSLVHAGARVSLRCHSELAFDEFILYKEGHIQHSQQLDQGMEAGIHYVEAVF
SMGPITPAHAGAYRCCGCFSHSRYEWSAPSDSLDIVITGKYKKPSLSTQVGPMMRLGEKL
TLFCSSEISFDQYHLFRDGVAHGQWLSGGQRHRGAFQANFSVGPAMPVPGGTYRCYGSFN
DSPYEPPVTRCNFMPQTPPWQTQSPWKANGQMKRSLQKRHRRSYMPS
Download sequence
Identical sequences ENSGGOP00000006321 ENSGGOP00000006321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]