SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006354 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006354
Domain Number 1 Region: 106-203
Classification Level Classification E-value
Superfamily Fibronectin type III 7.99e-21
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 201-304
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-20
Family Fibronectin type III 0.00000339
Further Details:      
 
Domain Number 3 Region: 31-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000137
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006354   Gene: ENSGGOG00000006496   Transcript: ENSGGOT00000006524
Sequence length 372
Comment pep:known_by_projection chromosome:gorGor3.1:9:35231082:35269362:-1 gene:ENSGGOG00000006496 transcript:ENSGGOT00000006524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI
Download sequence
Identical sequences A0A2J8QS56 A0A2J8T0N7 G3QUF2
ENSGGOP00000006354 ENSGGOP00000006354 XP_003829850.1.60992 XP_003829851.1.60992 XP_003829852.1.60992 XP_004048004.1.27298 XP_004048005.1.27298 XP_018889672.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]