SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006388 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006388
Domain Number 1 Region: 63-494
Classification Level Classification E-value
Superfamily Sema domain 2.88e-112
Family Sema domain 0.00000176
Further Details:      
 
Domain Number 2 Region: 491-524
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000136
Family Plexin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 543-619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000759
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006388   Gene: ENSGGOG00000006525   Transcript: ENSGGOT00000006558
Sequence length 664
Comment pep:known_by_projection chromosome:gorGor3.1:15:54024236:54048195:-1 gene:ENSGGOG00000006525 transcript:ENSGGOT00000006558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPPPGRASPSAPRARVPGPPARSGLPLRLLLLLWAAATSAQGHLRSGPRIFAVWKGHV
GQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLD
KRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLF
EGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYY
FFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNR
LQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKDYHSSLPNPR
PGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGE
TFHVLYLTTDRGTIHKVVEPGEQEHSFVFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQ
WEVSQVPLDLCEVYNGGCHGCLMSRDPYCGWDQGHCVSIYSSERSVLQSINPAEPHKECP
NPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIEN
LTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLILG
LLVH
Download sequence
Identical sequences ENSGGOP00000006388 ENSGGOP00000006388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]