SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006450 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006450
Domain Number 1 Region: 286-404
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000349
Family C1 set domains (antibody constant domain-like) 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006450
Domain Number - Region: 251-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0514
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006450   Gene: ENSGGOG00000006593   Transcript: ENSGGOT00000006620
Sequence length 504
Comment pep:known_by_projection chromosome:gorGor3.1:6:34273577:34283762:-1 gene:ENSGGOG00000006593 transcript:ENSGGOT00000006620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLSLLLAVALGLATAVSAGPAVIECWFVEDASGKGLAKRPGALLLRQGPGEPPPRPDL
DPELYLNVHDPAGALQAAFRRYPRGAPAPHCEMSRFVPLPASAKWASGLTPAQNCPRALD
GAWLMVSISSPVLSLSSLLRPQPETQQEPVLITMATVVLTVLTHTPAPRVRLGQDALLDL
SFAYMPPTSEAASSLAPGPPPFGLEWRRQHLGKGHLLLAATPGLNGRMPAAQEGAVAFAA
WDDDEPWGPWTGNGTFWLPRVQPFQEGTYLATIHLPYLQGQVTLELAVYKPPKVSLMPAT
LARAAPGEVPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHSDGSV
SLSGHLQPPPVTTEQHGARYACRIHHPSLPASGRSAEVTLEVAGLSGPSLEDSVGLFLSA
FLLLGLFKALGWAAVYLSTCKDSKKVQCSTSLYLSLVTLSPHPISEPMEGGCWCGRQNLG
LESTLIWAKTWHYILTVGLFKRAT
Download sequence
Identical sequences G3QUP3
ENSGGOP00000006450 XP_004043866.1.27298 ENSGGOP00000006450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]