SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006537 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006537
Domain Number 1 Region: 49-190
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.88e-39
Family Carbonic anhydrase 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006537   Gene: ENSGGOG00000006678   Transcript: ENSGGOT00000006708
Sequence length 199
Comment pep:novel chromosome:gorGor3.1:16:78544334:78590988:-1 gene:ENSGGOG00000006678 transcript:ENSGGOT00000006708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGRNTWKTSAFSLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGG
TRQSPINIQWRDSVYDPQLKPLRVSYDAASCLYVWNTGYLFQVEFDDATEASGISGGPLE
NHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELSAFRTLLFSALGEEEKMMVNNFRPLQP
LMNRKVWASFQATNEGTRS
Download sequence
Identical sequences ENSGGOP00000006537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]