SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006548 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006548
Domain Number 1 Region: 37-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000579
Family I set domains 0.00000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006548   Gene: ENSGGOG00000006694   Transcript: ENSGGOT00000006720
Sequence length 207
Comment pep:known_by_projection chromosome:gorGor3.1:11:116233146:116247481:1 gene:ENSGGOG00000006694 transcript:ENSGGOT00000006720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKEKP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
Download sequence
Identical sequences G3QUY7
ENSGGOP00000006548 ENSGGOP00000006548 XP_004052260.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]