SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006549 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006549
Domain Number 1 Region: 578-752
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 914-1021
Classification Level Classification E-value
Superfamily POZ domain 3.84e-23
Family BTB/POZ domain 0.0036
Further Details:      
 
Domain Number 3 Region: 201-251,329-389
Classification Level Classification E-value
Superfamily Histone-fold 1.39e-20
Family Nucleosome core histones 0.0098
Further Details:      
 
Domain Number 4 Region: 123-191
Classification Level Classification E-value
Superfamily Histone-fold 0.00000279
Family Nucleosome core histones 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006549   Gene: ENSGGOG00000006683   Transcript: ENSGGOT00000006721
Sequence length 1104
Comment pep:known_by_projection chromosome:gorGor3.1:12:106774298:107107491:1 gene:ENSGGOG00000006683 transcript:ENSGGOT00000006721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMH
SRHNSFDTVNTALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELEALLLRSRDPRAGPAV
PGGLPKDALAKLSTLVSRALVRIAKEAQRLSLRFAKCTKYEIQSAMEIVLSWGLAAHCTA
AALAALSLYNMSSAGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTAC
MESLFRDIYSRVVASGVPRSCSGPGSGSGSGPGPSSGPGAAPAADKEREAPGGGVASGGA
CSAASSASGGSSCCAPPAAAAAAVPPAAAANHHHHHHHALHEAPKFTVETLEHTVNNDSE
IWGLLQPYQHLICGKNASGVLCLPDSLNLHRDPQRSNKPGELPMFSQSELRTIEQSLLAT
RVGSIAELSDLVSRAMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQME
WENPNVEPSKVNLQVERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGV
DCEPRQLRADDCFCASRKLDAVAIEAKFKQDLGFRMLNCGRTDLVKQAVSLLGPDGINTM
SEQGMTPLMYACVRGDEAMVQMLLDAGADLNVEVVSTPHKYPSVHPETRHWTALTFAVLH
GHIPVVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGNFELVSLLLERGADPLIGTMY
RNGISTTPQGDMNSFSQAAAHGHRNVFRKLLAQPEKEKSDILSLEEILAEGTDLAETAPP
PLCASRNSKAKLRALREAMYHSAEHGYVDVTIDIRSIGVPWTLHTWLESLRIAFQQHRRP
LIQCLLKEFKTIQEEEYTEELVTQGLPLMFEILKASKNEVISQQLCVIFTHCYGPYPIPK
LTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSKPTNDG
TCIEIGYVKYSIFQLVMQYLYYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAK
SINTDNCVDIYNHAKFLGVTELSAYCEGYFLKNMMVLIENEAFKQLLYDKNGEGTGQDVL
QDLQRTLAIRIQSIHLSSSKGSVV
Download sequence
Identical sequences G3QUY8
XP_004053870.1.27298 ENSGGOP00000006549 ENSGGOP00000006549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]