SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006561 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006561
Domain Number 1 Region: 44-342
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006561   Gene: ENSGGOG00000006704   Transcript: ENSGGOT00000006733
Sequence length 345
Comment pep:known_by_projection chromosome:gorGor3.1:10:57806496:57859604:-1 gene:ENSGGOG00000006704 transcript:ENSGGOT00000006733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSDPSMWTARGPFRRDRWSSEDEEAAGPSQTLSPLLSDTRKIVSEGELDQLAQIRPLIF
NFHEQTAIKDCLKILEKKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPY
DSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNLNVIAMIT
REIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKH
LQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCAIVK
NCSFNIMDIVAQMREQRSGMVQTKEQYHFCYNIVLEVLRKLLTLD
Download sequence
Identical sequences ENSGGOP00000006561 ENSGGOP00000006561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]