SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006649
Domain Number 1 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 216-266
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000497
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 272-319
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000124
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 4 Region: 798-838
Classification Level Classification E-value
Superfamily DEATH domain 0.000000746
Family DEATH domain, DD 0.0009
Further Details:      
 
Domain Number 5 Region: 19-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000238
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006649   Gene: ENSGGOG00000006788   Transcript: ENSGGOT00000006822
Sequence length 863
Comment pep:known_by_projection chromosome:gorGor3.1:8:35727847:35991491:1 gene:ENSGGOG00000006788 transcript:ENSGGOT00000006822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQN
EHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIA
YLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHN
LIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKR
SRTCTNPAPLNGGAFCEGMSVQKITCTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAP
PPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAAV
VAVAVLVIGVTLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLTV
SRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERAEYHGKNHSRTF
PHGNNHSFSTMHPRNKTPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNTGVSLLIPHGA
IPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEH
WNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVKQ
LKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSL
QISVLDIPPFLWRIKPFTACQEVPFSRVWCSNRQPLHCAFSLERYTPTTTQLSCKICIRQ
LKGHEQILQVQTSILENLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGRTHT
KLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences ENSGGOP00000006649 ENSGGOP00000006649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]