SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006663 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006663
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-41
Family Frizzled cysteine-rich domain 0.00000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006663   Gene: ENSGGOG00000006816   Transcript: ENSGGOT00000006836
Sequence length 493
Comment pep:known_by_projection chromosome:gorGor3.1:5:39527540:39529405:-1 gene:ENSGGOG00000006816 transcript:ENSGGOT00000006836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAP
VCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSED
GAPALLNATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
LWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVV
CNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAI
EANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLF
IGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQA
FREHWERSWFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGKKEKKKT
GVWAPGLKNEVCV
Download sequence
Identical sequences ENSGGOP00000006663 ENSGGOP00000006663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]