SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006728 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006728
Domain Number 1 Region: 25-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.02e-17
Family I set domains 0.045
Further Details:      
 
Domain Number 2 Region: 221-319
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000568
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 101-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000153
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006728   Gene: ENSGGOG00000006872   Transcript: ENSGGOT00000006904
Sequence length 386
Comment pep:known_by_projection chromosome:gorGor3.1:19:510569:521474:1 gene:ENSGGOG00000006872 transcript:ENSGGOT00000006904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEG
QGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLTEEDTGTYECRASNDPDRNHLT
RAPRVKWVRAQAVVLVLEPGTVLTTVEELGSKILLTCSLNDSATEVTGHRWLKGGVVLKE
DALPGQKTEFEVDSDDQWGEYSCVFLPEPMGTANIKLHHGPPRVKAVKLSEHINEGETAV
LACKSESVPPVTDWAWYKITDSGDKALTNGSESRFFVSSSQGRSELYIENLNMEADPGQY
RCNGTSSKGSDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDD
AGSAPLKSSGQHQNDKGKNVRQRNSS
Download sequence
Identical sequences ENSGGOP00000006728 ENSGGOP00000006728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]