SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006865 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000006865
Domain Number - Region: 117-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00122
Family I set domains 0.045
Further Details:      
 
Domain Number - Region: 15-87
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00968
Family I set domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006865   Gene: ENSGGOG00000007017   Transcript: ENSGGOT00000007046
Sequence length 289
Comment pep:known_by_projection chromosome:gorGor3.1:5:4991945:5010268:-1 gene:ENSGGOG00000007017 transcript:ENSGGOT00000007046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITPVVSIAYKVLEVFPKGRWVLITCHAPQPPLPTTYSLCGTKNIKVAKKVVKTHKLASFN
LNVTLKSSPDLLTYFCRAASTSGAHVDSARLQMYWELWSKPVSELRANFTLQDRGAGPRV
EMICQASSGSPPITYSLIGKDGQVHLQQRPRHRQPANFFFLPSQTSDWFRCQAANNVNVQ
HSALTVVPPGERALGFPEGQLAFLCREGASVQDTGRWEVGQLYPATAESREGTGGNHAHP
GPCLKEAQPSCLRPLPGGLPRAPTIVLVGSLASTAAITSRMLGWTTWAR
Download sequence
Identical sequences ENSGGOP00000006865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]