SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006982 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006982
Domain Number 1 Region: 357-455
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-27
Family I set domains 0.0006
Further Details:      
 
Domain Number 2 Region: 60-155
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-23
Family I set domains 0.00000672
Further Details:      
 
Domain Number 3 Region: 157-256
Classification Level Classification E-value
Superfamily Immunoglobulin 5.35e-23
Family I set domains 0.00000531
Further Details:      
 
Domain Number 4 Region: 259-354
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-20
Family I set domains 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006982   Gene: ENSGGOG00000007138   Transcript: ENSGGOT00000007168
Sequence length 699
Comment pep:known_by_projection chromosome:gorGor3.1:19:52120960:52136046:1 gene:ENSGGOG00000007138 transcript:ENSGGOT00000007168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRTEPPSVHALCVLSCQHRGLIHPQSSAVGGDAMTPILTVLICLGLSLDPRTHVQAGP
LPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPI
PSITWEHAGRYRCIYGSHTAGRSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQC
DSQVAFDGFILCKEREDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYAYDSNSP
YVWSLPSDLLELLVPGVSKKPSLSVQPGPVMAPGESMTLQCGCDVGYDRFVLYMEGDREF
LQLLGQPQSGLSQTKVTLGPVSPSHGGQYRCYGAHNLSSKWSAPSDPLDILIAGQIPARP
SLSVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLHLRSTHKSPKYQAEFRMGP
VTSAHAGTYRCYSSLSSNPYLLSLPSEPLELVVSGPSGGPSSPTIGPTSTSAGPEDQPLI
PTGSDPQSAPGLGSGAGTRAAGLGSHLGVVIGILVAVVLLLLLLLLLFLILRHQRQGKRW
TSTQRKADFQHPARAVGPELTDRGLQRRSSPAADAQEENLYAAVKDTQPEDGVEMDTQQS
PHNEDPQAVTYAEVKHSRPRREMASPPSPLSEEFLDTKDTQAEEDRQMDTQAAASEASQD
VTYAQLHSLTLRREATEPPPSQEGASPAEPSVYATLAIH
Download sequence
Identical sequences ENSGGOP00000006982 ENSGGOP00000006982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]