SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007005 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007005
Domain Number 1 Region: 41-507
Classification Level Classification E-value
Superfamily Sema domain 5.36e-131
Family Sema domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 1312-1439,1635-1824
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 952-1039
Classification Level Classification E-value
Superfamily E set domains 2.57e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 4 Region: 858-952
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000233
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 1037-1141
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000187
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000157
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1138-1227
Classification Level Classification E-value
Superfamily E set domains 0.00000132
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007005
Domain Number - Region: 809-841
Classification Level Classification E-value
Superfamily Plexin repeat 0.000112
Family Plexin repeat 0.0031
Further Details:      
 
Domain Number - Region: 654-686
Classification Level Classification E-value
Superfamily Plexin repeat 0.0366
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007005   Gene: ENSGGOG00000007146   Transcript: ENSGGOT00000007191
Sequence length 1854
Comment pep:known_by_projection chromosome:gorGor3.1:7:130294859:130677103:-1 gene:ENSGGOG00000007146 transcript:ENSGGOT00000007191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERT
GHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLI
DYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLD
DKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDF
DIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGC
ERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIFIL
KQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGP
VLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKE
RCERSKEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSE
MDGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHN
SCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPI
TLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVE
LTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESRWLELSGANSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVS
VQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFFAELQTDI
HELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLIN
NKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESK
NHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGE
ARYSLSEDKLIRQQIDYKTLVLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNV
PCSHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSK
QVTAYNAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEH
GDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFL
DEQADKHGIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMD
SCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMH
MNEFNTMSALSEIFSYVGKYSEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences G3QW56
ENSGGOP00000007005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]