SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007058 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007058
Domain Number 1 Region: 699-888
Classification Level Classification E-value
Superfamily Fibronectin type III 4.85e-42
Family Fibronectin type III 0.00037
Further Details:      
 
Domain Number 2 Region: 615-706
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-21
Family I set domains 0.0087
Further Details:      
 
Domain Number 3 Region: 67-159
Classification Level Classification E-value
Superfamily Immunoglobulin 6.18e-19
Family I set domains 0.0083
Further Details:      
 
Domain Number 4 Region: 411-509
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 330-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000166
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 236-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000134
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 518-604
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000182
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007058   Gene: ENSGGOG00000007208   Transcript: ENSGGOT00000007244
Sequence length 903
Comment pep:known_by_projection chromosome:gorGor3.1:11:18951492:18969204:-1 gene:ENSGGOG00000007208 transcript:ENSGGOT00000007244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTIHSRQMLQEHVSMEFSSSTTHMQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNI
PAGDSVPEFVEKPQPVTAPEGDKAVFRARVQGNPKPHISWKRESGIPIKESAKIFYDSIN
KEHVLKLEPLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKK
KQKKVANEKEMLEILSKVPKKDFEKVCMEYGFTDFRGLLRKLKEMKKKVEVEAIRILKPL
EDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISNV
NMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFVW
KFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPIK
FVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDA
QLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDE
KVEGVWLKDGKEITDLPGVQIVKHGAVHKLIFPSMGPEHEGKYTFRAKGAESEASVFIAD
PPTIDPSVLEALAAHPITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGE
DQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLEPPGFASQPQVTDVTKEAVTIT
WNAPTQDGGAPVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNK
AGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDSSNSSISLAWREPAEGDPPSGYILEMRA
EDTKEWSKCTKIPISGTCYTVGGLTERQKYFFRIRAVNEAGVGEPVELDEGVCAMPPPGL
TTT
Download sequence
Identical sequences ENSGGOP00000007058 ENSGGOP00000024282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]