SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007118 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007118
Domain Number 1 Region: 332-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-69
Family SPRY domain 0.00000818
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 159-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000012
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007118
Domain Number - Region: 258-303
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0455
Family YkuI C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007118   Gene: ENSGGOG00000007271   Transcript: ENSGGOT00000007305
Sequence length 512
Comment pep:known_by_projection chromosome:gorGor3.1:6:27257331:27315345:1 gene:ENSGGOG00000007271 transcript:ENSGGOT00000007305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYEDGGIHLECRSTGWYPQPQIQWS
NNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADP
FFRSAQSWIAALAGTLSVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQ
EQSTRVKLLEELRWRSIQYASRGERHSAYNKWKKALFKPADVILDPKTANPILLVSEDQR
SVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPTKVGIFLDYETGEISFYNATDGS
HIYTFPHASFSEPLYPVFRILTLEPTALTICP
Download sequence
Identical sequences ENSGGOP00000007118 ENSGGOP00000007118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]