SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007166 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007166
Domain Number 1 Region: 227-476,710-800
Classification Level Classification E-value
Superfamily ARM repeat 8.49e-36
Family Armadillo repeat 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007166
Domain Number - Region: 847-944
Classification Level Classification E-value
Superfamily POZ domain 0.000118
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007166   Gene: ENSGGOG00000007323   Transcript: ENSGGOT00000007356
Sequence length 1030
Comment pep:known_by_projection chromosome:gorGor3.1:16:32245669:32254495:1 gene:ENSGGOG00000007323 transcript:ENSGGOT00000007356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLGAGVRLFTGVYPVVLNQIRATSETSAITRTTMPAPELTSTSRAEDTRDTGVQLRKR
KIPQARHSRKRQRTFSFRSLGSAARSGAESEARAKMAAAKPTLTDSLSFCLAQLAAAAGE
ALGGEKDPATNETPLSRALLALRTRHIKAAGGIERFRARGGLRPLLALLRRAAAAGSAPS
QAGPGSAPSSAASAASSPAPASGPAPSAVSSSSPTPPVRLRKTLDLALSILADCCTEGAC
RTEVRRLGGILPLVTILQCMKTDSIQNRTARALGNLAMEPESCGDIHCAGAVPLLVESLT
ACQDSQCLQSVVRALRNLADSPQHRLALAQQGAVRPLAELLATAPDAALTLALVRALLEL
SRGCSRACAEQLSLGGGLGPLVSLASHPKRAVREGTILILANLCAQGLIRPALGNAGGVE
VLVDELRQRRDPNGASPTSQQPLVRAVCLLCREAINRARLRDAGGLDLLMGLLRDPRASA
WHPRIVAALVGFLYDSGALGRLQALGLVPLLAGQLCGEAGEEEEEGREAASWDFPEERTP
ERAQGGSFRSLRSWLISEGYATGPDDISPDWSPEQCPPEPMEQASPAPTPTSLRAPRTQR
TPGRSPAAAIEEPWGREGPALLLLSRFSQAPDPSGALVTGPALYGLLTYVTGAPGPPSPR
ALRILSRLTCNPACLEAFVRSYGAALLRAWLVLGVAPDDWPAPRARPTLHSRHRELGERL
LQNLTVQAESPFGVGALTHLLLSGSPEDRVACALTLPFICRKPSLWRRLLLEQGGLRLLL
AALTRPAPHPLFLFFAADSLSCLQDLVSPTVSPAVPQAVPMDLDSPSPCLYEPLLGPAPV
PAPDLHFLLDSGLQLPAQRAASATASPFFRALLSGSFAEAQMDLVPLRGLSPGAAWPVLH
HLHGCRGCGAALGPVPPPGQPLLGSEAEEALEAAGRFLLPGLEEELEEAVGRIHLGPQGG
PESVGEVFRLGRPRLAAHCARWTLGSEQCPRKRGLALVGLVEAAGEEAGPLTEALLAVVM
GIELGARVPA
Download sequence
Identical sequences G3QWK6
XP_018867778.1.27298 ENSGGOP00000007166 ENSGGOP00000007166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]