SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007171 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007171
Domain Number 1 Region: 112-371,605-696
Classification Level Classification E-value
Superfamily ARM repeat 4.39e-36
Family Armadillo repeat 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007171
Domain Number - Region: 742-839
Classification Level Classification E-value
Superfamily POZ domain 0.000102
Family BTB/POZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007171   Gene: ENSGGOG00000007323   Transcript: ENSGGOT00000007361
Sequence length 925
Comment pep:known_by_projection chromosome:gorGor3.1:16:32246919:32254495:1 gene:ENSGGOG00000007323 transcript:ENSGGOT00000007361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAKPTLTDSLSFCLAQLAAAAGEALGGEKDPATNETPLSRALLALRTRHIKAAGGIER
FRARGGLRPLLALLRRAAAAGSAPSQAGPGSAPSSAASAASSAVSSSSPTPPVRLRKTLD
LALSILADCCTEGACRTEVRRLGGILPLVTILQCMKTDSIQNRTARALGNLAMEPESCGD
IHCAGAVPLLVESLTACQDSQCLQSVVRALRNLADSPQHRLALAQQGAVRPLAELLATAP
DAALTLALVRALLELSRGCSRACAEQLSLGGGLGPLVSLASHPKRAVREGTILILANLCA
QGLIRPALGNAGGVEVLVDELRQRRDPNGASPTSQQPLVRAVCLLCREAINRARLRDAGG
LDLLMGLLRDPRASAWHPRIVAALVGFLYDSGALGRLQALGLVPLLAGQLCGEAGEEEEE
GREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDDISPDWSPEQCPPEPMEQAS
PAPTPTSLRAPRTQRTPGRSPAAAIEEPWGREGPALLLLSRFSQAPDPSGALVTGPALYG
LLTYVTGAPGPPSPRALRILSRLTCNPACLEAFVRSYGAALLRAWLVLGVAPDDWPAPRA
RPTLHSRHRELGERLLQNLTVQAESPFGVGALTHLLLSGSPEDRVACALTLPFICRKPSL
WRRLLLEQGGLRLLLAALTRPAPHPLFLFFAADSLSCLQDLVSPTVSPAVPQAVPMDLDS
PSPCLYEPLLGPAPVPAPDLHFLLDSGLQLPAQRAASATASPFFRALLSGSFAEAQMDLV
PLRGLSPGAAWPVLHHLHGCRGCGAALGPVPPPGQPLLGSEAEEALEAAGRFLLPGLEEE
LEEAVGRIHLGPQGGPESVGEVFRLGRPRLAAHCARWTLGSEQCPRKRGLALVGLVEAAG
EEAGPLTEALLAVVMGIELGARVPA
Download sequence
Identical sequences ENSGGOP00000007171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]