SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007195 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007195
Domain Number 1 Region: 499-689
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-46
Family Fibronectin type III 0.0000543
Further Details:      
 
Domain Number 2 Region: 818-1014
Classification Level Classification E-value
Superfamily Fibronectin type III 8.69e-38
Family Fibronectin type III 0.0000162
Further Details:      
 
Domain Number 3 Region: 296-390
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-24
Family I set domains 0.0055
Further Details:      
 
Domain Number 4 Region: 213-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-24
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 400-495
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-21
Family Fibronectin type III 0.0000574
Further Details:      
 
Domain Number 6 Region: 111-207
Classification Level Classification E-value
Superfamily Immunoglobulin 6.79e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 693-787
Classification Level Classification E-value
Superfamily Fibronectin type III 3.07e-16
Family Fibronectin type III 0.0000095
Further Details:      
 
Domain Number 8 Region: 14-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000472
Family I set domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007195   Gene: ENSGGOG00000007343   Transcript: ENSGGOT00000007385
Sequence length 1419
Comment pep:known_by_projection chromosome:gorGor3.1:18:50571542:51351963:1 gene:ENSGGOG00000007343 transcript:ENSGGOT00000007385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWKKDGIHLALGMDER
KRQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRFLSQTES
VTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIG
IYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPP
PSFTWLRGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVL
VPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKNGDVVIPSDYFQIVGGSNLRIL
GVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSSVLPSAPRDVVPVLVSSRFVRLS
WRPPAEVKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEW
GPGESSQPIKVATQPELQVPGPVENLQAVSTSPTSILITWEPPAYANGPVQGYRLFCTEV
STGKEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQN
VSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLEPNNLWYLFTGLEK
GSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPP
LNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPL
YESATTRSVTDPTDPVDYYPLLDDFPTSVPDLSTPMLPPVGVQAVALTHDAVRVSWADNS
VPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRS
STWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLEANGKITAYILFYTLDK
NIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNSKGVGPLSDPILFRTLKVEHPD
KMANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGV
ITVLVVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEMKNIEKP
SGTDPAGRDSPIQSCQDLTPVSHSQSETQLGSKSTSHSGQDTEEAGSSMSTLERSLAARR
APRAKLMIPMDAQSNNPAVVSAIPVPTLESAQYPGILPSPTCGYPHPQFTLRPVPFPTLS
VDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEHSSSEEAPSRTIPTACVRPTHPLRSFANP
LLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEE
SHKPTEDSTNVYEQDDLSEQMASLEGLMKQLNAITGSAF
Download sequence
Identical sequences ENSGGOP00000007195 ENSGGOP00000007195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]