SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007216 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000007216
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00126
Family Fibronectin type I module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007216   Gene: ENSGGOG00000007374   Transcript: ENSGGOT00000007407
Sequence length 139
Comment pep:known_by_projection chromosome:gorGor3.1:9:36487491:36488779:-1 gene:ENSGGOG00000007374 transcript:ENSGGOT00000007407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPGAPAPHSS
Download sequence
Identical sequences G3QWQ0 Q1L6U9
9606.ENSP00000419194 ENSP00000419194 ENSP00000419194 ENSGGOP00000007216 NP_001037729.1.87134 NP_001037729.1.92137 XP_003829891.1.60992 XP_004048049.1.27298 gi|112984108|ref|NP_001037729.1| ENSGGOP00000007216 ENSP00000419194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]