SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007270 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007270
Domain Number 1 Region: 230-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-69
Family SPRY domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 38-146
Classification Level Classification E-value
Superfamily Immunoglobulin 8.56e-17
Family V set domains (antibody variable domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007270   Gene: ENSGGOG00000007428   Transcript: ENSGGOT00000007462
Sequence length 475
Comment pep:known_by_projection chromosome:gorGor3.1:1:44313008:44344098:1 gene:ENSGGOG00000007428 transcript:ENSGGOT00000007462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMASSAGSWLSGCLIPLVFLRLSVHVSGRAGDAGKFHVALLGGTAELLCPLSLWPGTVP
KEVRWLRSPFPQRSQAVHVFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLED
QGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQR
RSKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAV
TLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVG
DKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGI
FLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE
STVPKPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKVPSF
Download sequence
Identical sequences ENSGGOP00000007270 ENSGGOP00000007270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]