SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007278 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007278
Domain Number 1 Region: 218-309
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-19
Family I set domains 0.0078
Further Details:      
 
Domain Number 2 Region: 128-208
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 68-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000321
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007278   Gene: ENSGGOG00000007438   Transcript: ENSGGOT00000007471
Sequence length 351
Comment pep:known_by_projection chromosome:gorGor3.1:1:73560385:74461207:-1 gene:ENSGGOG00000007438 transcript:ENSGGOT00000007471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMMLLVQGACCSNQWLAAVLLSLCCLLPTCLPCNILLLLSVCLLINSVVSLIICRCYLE
DGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQ
HTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFE
NGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLI
RCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKL
GTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ
Download sequence
Identical sequences ENSGGOP00000007278 ENSGGOP00000007278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]