SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007309 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007309
Domain Number 1 Region: 287-537
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.66e-89
Family Eukaryotic proteases 0.0000486
Further Details:      
 
Domain Number 2 Region: 194-298
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-18
Family Hepsin, N-terminal domain 0.04
Further Details:      
 
Domain Number 3 Region: 154-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007309   Gene: ENSGGOG00000007461   Transcript: ENSGGOT00000007502
Sequence length 541
Comment pep:known_by_projection chromosome:gorGor3.1:21:31019379:31043524:-1 gene:ENSGGOG00000007461 transcript:ENSGGOT00000007502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVGPKPLPTLLCGGRTGHRTAWVLSFLIRSCPCEPGKGCVYGKPVILWPTISSVVPST
FLGLGNYEVEVEAEPDVRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAV
AAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCDGVS
DCKDGEDEYRCAHRPVRVSGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVS
SDNLRVSLLEGQFREEFVSINHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRG
YSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIVTAAHCVYDLYLPKSWTIQV
GLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLAFNEMIQPVCLPNSEENF
PDGKVCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGG
VDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLK
T
Download sequence
Identical sequences ENSGGOP00000007309 ENSGGOP00000007309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]