SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007372 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007372
Domain Number 1 Region: 31-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000309
Family V set domains (antibody variable domain-like) 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007372   Gene: ENSGGOG00000007534   Transcript: ENSGGOT00000007568
Sequence length 233
Comment pep:known_by_projection chromosome:gorGor3.1:6:42474121:42484652:-1 gene:ENSGGOG00000007534 transcript:ENSGGOT00000007568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDCTLEEFASSKAWQIIRDG
EMPKTLACTERPSENSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKE
PHMLFDCIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALRPLYTSPRTVTQAPPKSTA
DVSTPDSEINLTNVTNIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP
Download sequence
Identical sequences G3QX41
ENSGGOP00000007372 ENSGGOP00000007372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]