SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007441 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007441
Domain Number 1 Region: 449-578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000132
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 2 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000245
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 636-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000529
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 716-825
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000091
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 349-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000298
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 671-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000244
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 307-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007441
Domain Number - Region: 601-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000324
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 831-873
Classification Level Classification E-value
Superfamily FnI-like domain 0.00157
Family VWC domain 0.095
Further Details:      
 
Domain Number - Region: 425-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007441   Gene: ENSGGOG00000007597   Transcript: ENSGGOT00000007639
Sequence length 1199
Comment pep:known_by_projection chromosome:gorGor3.1:14:87205527:87232519:-1 gene:ENSGGOG00000007597 transcript:ENSGGOT00000007639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCSCPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVDTNDCNPLPCYNGGICVDGVNWFRCECAPGF
AGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPF
PHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCL
RPPCEAWGECGAEEPPSTPCLPRSGHLDNNCARLTLRFNRDHVPQGTTVGAICSGIRSLP
ATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNS
SLLLAVTEVKVETVVTGGSSTGLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLP
REESTNNQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEE
DEDLGRGEEDSLEAEKFLSHKFTKDPGRSPGRPGHWASGPKVDNRAVRSINEARYAGKE
Download sequence
Identical sequences G3QXA1
ENSGGOP00000007441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]