SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007468 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007468
Domain Number 1 Region: 86-197
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.92e-36
Family Frataxin-like 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007468   Gene: ENSGGOG00000007636   Transcript: ENSGGOT00000007669
Sequence length 210
Comment pep:known_by_projection chromosome:gorGor3.1:9:50549604:50588636:1 gene:ENSGGOG00000007636 transcript:ENSGGOT00000007669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTVIDATCTPRHASSNLR
GLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTF
EDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGV
SLHELLAAELTKALKTKLDLSSLAYSGKDA
Download sequence
Identical sequences A0A2I2ZHU2
ENSGGOP00000007468 ENSGGOP00000007468 XP_004048150.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]