SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007474 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007474
Domain Number 1 Region: 35-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.62e-48
Family Ribosomal protein S7 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007474   Gene: ENSGGOG00000007640   Transcript: ENSGGOT00000007675
Sequence length 242
Comment pep:known_by_projection chromosome:gorGor3.1:5:8005046:8015326:-1 gene:ENSGGOG00000007640 transcript:ENSGGOT00000007675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTE
EEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKR
KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRR
FLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYR
WW
Download sequence
Identical sequences G3QXD3
ENSGGOP00000007474 ENSGGOP00000007474 XP_004041040.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]