SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007485 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007485
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000469
Family V set domains (antibody variable domain-like) 0.038
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007485
Domain Number - Region: 144-288
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0288
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007485   Gene: ENSGGOG00000007652   Transcript: ENSGGOT00000007687
Sequence length 323
Comment pep:known_by_projection chromosome:gorGor3.1:3:107199969:107249912:-1 gene:ENSGGOG00000007652 transcript:ENSGGOT00000007687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLVAALLLGSAXXXSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLMITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRKAVEEPLNAFKESKGMMNDE
Download sequence
Identical sequences G3QXE4
ENSGGOP00000007485 ENSGGOP00000007485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]