SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007495 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007495
Domain Number 1 Region: 28-513
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-184
Family ALDH-like 0.0000000000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007495   Gene: ENSGGOG00000007661   Transcript: ENSGGOT00000007697
Sequence length 518
Comment pep:known_by_projection chromosome:gorGor3.1:15:37074007:37193484:-1 gene:ENSGGOG00000007661 transcript:ENSGGOT00000007697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences A0A2I2URL8 A0A2K5CD43 A0A2K6UQZ9 F1PGT3 F7CVL4 G3QXF4 H2Q9I2
ENSCAFP00000024344 ENSGGOP00000007495 NP_001274018.1.84170 XP_001172159.1.37143 XP_001500420.1.31192 XP_002717750.1.1745 XP_003827933.1.60992 XP_003929025.1.74449 XP_004056304.1.27298 XP_008520028.1.77740 XP_011281203.1.62641 XP_012298448.1.9421 XP_014926375.1.86478 XP_019297517.1.44245 XP_019587869.1.88060 XP_019587870.1.88060 ENSECAP00000012983 ENSGGOP00000007495 ENSCAFP00000024344 ENSPTRP00000012165 ENSECAP00000012983 9598.ENSPTRP00000012165 9615.ENSCAFP00000024319 9796.ENSECAP00000012983 9986.ENSOCUP00000014561 ENSOCUP00000014561 ENSPTRP00000012165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]