SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007497 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007497
Domain Number 1 Region: 4-429
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-127
Family ALDH-like 0.0000000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007497   Gene: ENSGGOG00000007664   Transcript: ENSGGOT00000007699
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:5:59993796:60022352:-1 gene:ENSGGOG00000007664 transcript:ENSGGOT00000007699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSEFNVYSQE
VLTVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKRRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KKYQAVLRRKALLIFLVVHRLRWSSKQR
Download sequence
Identical sequences A0A2I2Z075
ENSGGOP00000007497 XP_004042167.1.27298 ENSGGOP00000007497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]