SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007516 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007516
Domain Number 1 Region: 248-550
Classification Level Classification E-value
Superfamily ALDH-like 6.54e-101
Family ALDH-like 0.000000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007516   Gene: ENSGGOG00000007682   Transcript: ENSGGOT00000007718
Sequence length 570
Comment pep:known_by_projection chromosome:gorGor3.1:5:59915482:59920865:1 gene:ENSGGOG00000007682 transcript:ENSGGOT00000007718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWRRRPRLSRTSSTSTRSHWAWSSSLAPGTTPSTSPSSPWWAPSLQVHGPVGREAGGA
PSPSVEPSQDGLRPVLRVLGSDKGLLGLSQEAVGTKLFSQASWCLRSSQAQVSTPDDTER
ACLPPPLLGGWSFCHLICIRASFLEWASTVLPTRPPEPLSPFCFSSNISATQRARWCSSG
QRVPVCVPLSCARACSWVCPVTCACLLTTLPSTVPRTHKGGEASGVVLGRAEPLVKYPGH
RPGSVCSAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDH
ILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQT
CVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQKV
AYGGTGDVATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLA
LYIFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFS
HRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Download sequence
Identical sequences ENSGGOP00000007516 XP_018883134.1.27298 XP_018883135.1.27298 XP_018883137.1.27298 ENSGGOP00000024007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]