SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007620 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007620
Domain Number 1 Region: 114-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000181
Family I set domains 0.057
Further Details:      
 
Domain Number 2 Region: 205-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000301
Family I set domains 0.03
Further Details:      
 
Domain Number 3 Region: 20-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000764
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007620   Gene: ENSGGOG00000007786   Transcript: ENSGGOT00000007822
Sequence length 429
Comment pep:known_by_projection chromosome:gorGor3.1:1:136783461:136810816:-1 gene:ENSGGOG00000007786 transcript:ENSGGOT00000007822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRLLLLICAPLCEPAELLLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRA
LGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVYRVPVADVSLETQPP
GGQVMEGDRLVLICSVAMGTGDITFLWYKGVVGLNLQSKTQRSLTAEYEIPSARESDAEQ
YYCVAENGYGPSPSGLVSITVRIPVSRPVLMLRAPRAQAAVEDVLELHCEALRGSPPILY
WFYHEDITLGSRSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGA
RSNHLTSGVVEGLLSTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPLPQEFTYLNSP
TPGQLQPIYENVNVVSGDEVYSLAYYNQPEQESVAAETLGTHMEDKVSLDIYSRLRKANI
TDVDYEDAM
Download sequence
Identical sequences G3QXR2
ENSGGOP00000007620 ENSGGOP00000007620 XP_004027064.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]