SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007636 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007636
Domain Number 1 Region: 46-168
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000627
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 2 Region: 186-252
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000054
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007636   Gene: ENSGGOG00000007810   Transcript: ENSGGOT00000007840
Sequence length 328
Comment pep:known_by_projection chromosome:gorGor3.1:18:43367941:43384752:1 gene:ENSGGOG00000007810 transcript:ENSGGOT00000007840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSIQLLACLACVLSTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAA
VLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNP
RRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPGLA
HAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPGEGHGHLVTAELPALTHDGRYTCTAA
NSLGRSEASVYLFRFHGASGASTVALLLGALGLKALLLLGVLAARAARRRPEHLDTPDTP
PRSQAQESNYENLSQMNPRSPPATMCSP
Download sequence
Identical sequences G3QXS6
ENSGGOP00000007636 XP_004059410.1.27298 ENSGGOP00000007636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]