SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007642 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007642
Domain Number 1 Region: 80-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-42
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 531-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000004
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 485-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000572
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 318-382
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.016
Further Details:      
 
Domain Number 5 Region: 648-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000216
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007642
Domain Number - Region: 374-446
Classification Level Classification E-value
Superfamily FnI-like domain 0.000617
Family Fibronectin type I module 0.091
Further Details:      
 
Domain Number - Region: 451-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0021
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007642   Gene: ENSGGOG00000007812   Transcript: ENSGGOT00000007847
Sequence length 735
Comment pep:known_by_projection chromosome:gorGor3.1:12:42305140:42679481:-1 gene:ENSGGOG00000007812 transcript:ENSGGOT00000007847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFPPLLKGQASATRSSLASCSWVVFFLSCLSRHAPEIEGGRRWTELIRTMESRVLLRTF
CLIFGLGAVWGLGVDPCLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQDTPRSIKAS
TATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSGHRNEVRLHYR
SGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGTTFW
LGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAK
TSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWIDGCKNCTCLNGTIQCETLICPN
PDCPLKSALAYVDGKCCKECKSICQFQGQTYFEGERNTVYSSSGVCVLYECKDQTMKLVE
SSGCPALDCPESYQITLSHSCCKVCKVCKGYDFCSERHNCMENSVCRNLNDRAVCSCRDG
FRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECI
TNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVCACPQGF
TGPSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECG
TGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQIWVLENDRCSVCSCQN
GHICCSVDPQCLQEL
Download sequence
Identical sequences ENSGGOP00000007642 ENSGGOP00000007642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]