SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007698 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007698
Domain Number 1 Region: 1070-1407
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-25
Family NHL repeat 0.001
Further Details:      
 
Domain Number 2 Region: 765-840
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000922
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1303-1350,1378-1396,1423-1538
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000235
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007698
Domain Number - Region: 509-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000365
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 606-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000411
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 576-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 442-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00221
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 477-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00274
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 641-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00316
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 412-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 1751-1824,2037-2104,2161-2196
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0785
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007698   Gene: ENSGGOG00000007856   Transcript: ENSGGOT00000007905
Sequence length 2607
Comment pep:known_by_projection chromosome:gorGor3.1:5:152265612:152695566:1 gene:ENSGGOG00000007856 transcript:ENSGGOT00000007905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRPIPPTSSPSLLPSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRA
CSGPQQASSSGPPNHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAP
APNDLATTPESVQLQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTP
PPRLLPRNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQ
PADGHTFNNGIRTGLPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFW
RSQIHISQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRER
RSIQTLVQNEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECV
SGVCHCFPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGG
HGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCP
DQCSGHGTYLPDTGLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQ
RVCHPRCIEHGTCKDGKCECREGWNGEHCTIARQIGGRETNGCPDLCNGNGRCTLGQNSW
QCVCQTGWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLD
IIQQGQMDWPTVKSFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGV
NVSFVKYPKYGYTITRQDGTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTL
VMKTEENSIPSCDLSGFVRPDPIIISSPLSTFFSAAPGQNPIVPETQVLHEEIELPGSNV
KLRYLSSRTAGYKSLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWD
KTDAYGQRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHIL
NVKSGILHKGTGENQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGI
DGSLYVGDFNYIRRIFPSRNVTSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNS
RRIYRVKSLSGTKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNG
LMYFVDATMIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDN
SLYVLENNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGV
LYITETDEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPS
SLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVS
LVTGEYLYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGL
KVVSTQNLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHWEM
EKSITIDIENSNRDDDVTVITNLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGVS
FHSEPHVLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLL
SIDYDRNIRTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRG
AMSERTDIDKQGRIVSRMFADGKVWSYSYLDKSMVLLLQSQRQYIFEYDSSDRLLAVTMP
SVARHSMSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSK
LSEIVYDSTAVTFGYDETTGVLKMVNLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNA
RFDYTYHDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAV
MTLSKHFDTHGRIKEVQYEMFRSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDG
DGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDD
GYLCQRGSDIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLH
NPTRITHVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIK
QLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTMWKN
VGKEPAPFNLYMFKSNNPLSSELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPP
PYELSESQASENGQLITGVQQTTERHNQAFMALEGQVITKKLHASIREKAGHWFATTTPI
IGKGIMFAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSA
DGDLVTLGTTIGRKVLESGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDT
LDEEKARVLDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYV
LPVEQYPELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences ENSGGOP00000007698 ENSGGOP00000026715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]