SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007701 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007701
Domain Number 1 Region: 52-103
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000048
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007701   Gene: ENSGGOG00000007876   Transcript: ENSGGOT00000007908
Sequence length 387
Comment pep:known_by_projection chromosome:gorGor3.1:9:119355302:119361240:-1 gene:ENSGGOG00000007876 transcript:ENSGGOT00000007908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCSEPDPEVSRVPTVRGCNGSPSGALSCCEDSAQGSGPPKAPTVAEGPSSCLRRNVI
SERERRKRMSLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILASS
KEMWHSLQEDVLQLTLSSQIQAGVPDLGTGVSSGTRTPDVKAFLESPWSLDPSSSTPEPL
PHILASSGQWDPASCTSLGTDQCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRS
PLSWPPFSQQQTLPVMSGEALGWLGQAGPLALGAAPLGEPAEEDPMLAQEAGSALGSDVD
DGTSFLLTAGPSSWPGSLEGRGGSGPAWAPAESSPLDNGEPGFLGDPEPGSQELQDSPLE
PWGLDVDCAGLALKDEVESIFPDFFAC
Download sequence
Identical sequences G3QXY2
ENSGGOP00000007701 ENSGGOP00000007701 XP_004048903.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]