SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007720 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007720
Domain Number 1 Region: 415-551
Classification Level Classification E-value
Superfamily TIMP-like 4.39e-23
Family Netrin-like domain (NTR/C345C module) 0.014
Further Details:      
 
Domain Number 2 Region: 194-290
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-21
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 366-422
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0017
Further Details:      
 
Domain Number 4 Region: 115-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000846
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 316-362
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.012
Further Details:      
 
Domain Number 6 Region: 37-85
Classification Level Classification E-value
Superfamily Elafin-like 0.000000222
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007720   Gene: ENSGGOG00000007896   Transcript: ENSGGOT00000007927
Sequence length 558
Comment pep:known_by_projection chromosome:gorGor3.1:16:681028:684271:1 gene:ENSGGOG00000007896 transcript:ENSGGOT00000007927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPRPPGSVALMPALRPLLPLLLLLRLTSGAGLLPGPGSHPGVCPNQLSPNLWVDAQSTCE
RECSRDQDCAAAEKCCINVCGLRSCVAARFPGSPAAPTTAASCEGFACPQQGSDCDIWDG
QPVCRCRDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHIVPCKHVLSWPPSSPGP
PETTARPTPGAAPMPPALYSSPSPQAVQVGGTASLHCDVSGRPPPAVTWEKQSHQRENLI
MRPDQMYGNVVVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPARDAA
PSIPAPAECLPDVQACTGPTSPHLVLWHYDPQRGGCMTFPARGCDGAARGFETYEACQQA
CARGPGDACVLPAVQGPCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDACP
VPRTPPCRACRLRSKLALSLCRSDFAIVGRLTEVLEEPEAAGGIARVALEDVLKDDKMGL
KFLGTKYLEVTLSGMDWACPCPNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKK
ILELLEKQACELLNRFQD
Download sequence
Identical sequences ENSGGOP00000007720 ENSGGOP00000007720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]