SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007783 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007783
Domain Number 1 Region: 40-158
Classification Level Classification E-value
Superfamily Immunoglobulin 6.24e-17
Family V set domains (antibody variable domain-like) 0.000000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007783   Gene: ENSGGOG00000007961   Transcript: ENSGGOT00000007992
Sequence length 223
Comment pep:known_by_projection chromosome:gorGor3.1:2b:92399143:92404356:1 gene:ENSGGOG00000007961 transcript:ENSGGOT00000007992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY
ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR
AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Download sequence
Identical sequences A0A2I3SUF9 G3QY54 P16410
ENSP00000295854 NP_005205.2.87134 NP_005205.2.92137 XP_003820827.1.60992 XP_004033133.1.27298 XP_526000.1.37143 gi|21361212|ref|NP_005205.2| 9598.ENSPTRP00000021945 9606.ENSP00000303939 ENSGGOP00000007783 ENSPTRP00000021945 ENSP00000303939 ENSP00000303939 ENSPTRP00000021945 NYSGRC-IgSF-CTLA4_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]