SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007816 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007816
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.79e-72
Family Alanine racemase-like, N-terminal domain 0.00000000051
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.3e-49
Family Eukaryotic ODC-like 0.000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007816   Gene: ENSGGOG00000007991   Transcript: ENSGGOT00000008028
Sequence length 461
Comment pep:known_by_projection chromosome:gorGor3.1:2a:10666525:10674528:-1 gene:ENSGGOG00000007991 transcript:ENSGGOT00000008028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSKAIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL
LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV
Download sequence
Identical sequences G1RU71 G3QY86
XP_003272786.1.23891 XP_004028885.1.27298 XP_012353116.1.23891 XP_012353117.1.23891 XP_018876962.1.27298 ENSNLEP00000016796 ENSNLEP00000016796 ENSGGOP00000007816 ENSGGOP00000007816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]