SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007830 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007830
Domain Number 1 Region: 22-95
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-25
Family I set domains 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007830   Gene: ENSGGOG00000008009   Transcript: ENSGGOT00000008042
Sequence length 171
Comment pep:known_by_projection chromosome:gorGor3.1:11:116274709:116278376:-1 gene:ENSGGOG00000008009 transcript:ENSGGOT00000008042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHSTFLSGLVLATLLSQVNPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDVYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLAL
GVFCFAGHETGRPSGAADTQALLRNDQVYQPLRDRDDAHYSRLGGNWARNK
Download sequence
Identical sequences A0A2I2YH71
XP_004052262.1.27298 ENSGGOP00000007830 ENSGGOP00000007830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]