SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007834 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007834
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.24e-69
Family MHC antigen-recognition domain 0.000000131
Further Details:      
 
Domain Number 2 Region: 208-300
Classification Level Classification E-value
Superfamily Immunoglobulin 7.73e-28
Family C1 set domains (antibody constant domain-like) 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007834   Gene: ENSGGOG00000008012   Transcript: ENSGGOT00000008046
Sequence length 370
Comment pep:known_by_projection chromosome:gorGor3.1:6:31244600:31247307:1 gene:ENSGGOG00000008012 transcript:ENSGGOT00000008046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVMAPRTLLLLLLGALALTETWAGSHSLRYFSTAVSQPGRGEPRFIAVGYVDDTEFVRF
DSDSVSPRMERRAPWVEQEGLEYWDQETRNAKGHAQIYRVNLRTLLRYYNQSEADGSHTI
QRMHGCDVGPTGLLRRYEQFAYDGKDYIALNEDLRSWTAANTAAQISQHKWEADKYSEQV
RAYEGKCMEWLRRHLENSSECLGLHSDPPKAHVTRHPVSDHEATLRCWALGLYPVEITLT
WQQDGEDQTQDTELGETRPSGDGTFQNWMAVVVPSGEEQRYMCHVQHEGLPEPLTLRWEP
SSQPTIPIVGIIAGLFLPGAVVTGAVVAAAMWRKKSSGREGVRDGTRSYARAACSNCAQY
SDASHDTCKG
Download sequence
Identical sequences ENSGGOP00000007834 ENSGGOP00000007834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]