SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007835 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007835
Domain Number 1 Region: 45-155
Classification Level Classification E-value
Superfamily Immunoglobulin 3.86e-24
Family V set domains (antibody variable domain-like) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007835   Gene: ENSGGOG00000008014   Transcript: ENSGGOT00000008047
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:1:140397053:140402275:-1 gene:ENSGGOG00000008014 transcript:ENSGGOT00000008047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHC
SFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDG
SIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVL
LLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTK
AVSEKKAKGLGESRKDKK
Download sequence
Identical sequences ENSP00000337777 ENSP00000353634 XP_002809933.1.23681 XP_004027818.1.27298 ENSGGOP00000007835 9600.ENSPPYP00000000699 9606.ENSP00000353634 ENSGGOP00000007835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]