SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007881 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007881
Domain Number 1 Region: 20-238
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.58e-77
Family Phosphate binding protein-like 0.0000031
Further Details:      
 
Domain Number 2 Region: 240-298,332-353
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 2.88e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007881   Gene: ENSGGOG00000008055   Transcript: ENSGGOT00000008096
Sequence length 362
Comment pep:known_by_projection chromosome:gorGor3.1:11:117025399:117030934:1 gene:ENSGGOG00000008055 transcript:ENSGGOT00000008096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGSLRRAEGTEEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTT
GDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENP
HDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDE
QQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLH
DPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATI
HVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLND
AH
Download sequence
Identical sequences ENSGGOP00000007881 ENSGGOP00000007881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]