SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007885 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007885
Domain Number 1 Region: 180-504
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.71e-78
Family Pancreatic carboxypeptidases 0.00000187
Further Details:      
 
Domain Number 2 Region: 41-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.84e-32
Family Frizzled cysteine-rich domain 0.0008
Further Details:      
 
Domain Number 3 Region: 504-583
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.75e-18
Family Carboxypeptidase regulatory domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007885   Gene: ENSGGOG00000008061   Transcript: ENSGGOT00000008100
Sequence length 651
Comment pep:known_by_projection chromosome:gorGor3.1:4:9043983:9070386:1 gene:ENSGGOG00000008061 transcript:ENSGGOT00000008100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPPLLLLTVLVVAAARPGCXXXXXXXXECHRPPAADSATCVDLQLRTCSDAAYNHTTF
PNLLQHRSWEVVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGWVRRPCRHI
CEGLREVCQPAFDAIDMAWPYFLDCHRYFTREDEGCYDPLEKLRGGLEADEALPSGLPPT
FIRFSHHSYAQMVRVLRRTASRCAHVARTYSIGRSFDGRELLVIEFSSRPGQHELMEPEV
KLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAA
EGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPET
KAVMKWMQTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADV
HPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPE
EALYTLWQHNKESLLNFMEMVHRGIKGVVTDKFGKPLKNARISVKGIRHDITTAPDGDYW
RLLPPGIHIVIVQAPGYAKVIKKVIIPTRMKRAGRVDFILQPLGMGPKNFLHGLQRTGPH
DPLGGASSLGEATEPDPLRARRQPSADGNKPWWWSYFTSLSTHRPRWLLKY
Download sequence
Identical sequences ENSGGOP00000007885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]