SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007927 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007927
Domain Number 1 Region: 975-1287
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.48e-113
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000119
Further Details:      
 
Domain Number 2 Region: 1251-1525
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.3e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000208
Further Details:      
 
Domain Number 3 Region: 346-540
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-44
Family Fibronectin type III 0.00041
Further Details:      
 
Domain Number 4 Region: 538-696
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-30
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 57-151
Classification Level Classification E-value
Superfamily Immunoglobulin 5.12e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 6 Region: 259-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000522
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 161-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000879
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007927   Gene: ENSGGOG00000008094   Transcript: ENSGGOT00000008144
Sequence length 1534
Comment pep:known_by_projection chromosome:gorGor3.1:19:5316088:5396157:-1 gene:ENSGGOG00000008094 transcript:ENSGGOT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSARGLSVRDRGAIPLQGGDRRSLPSMAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPR
FIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQ
PLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATM
LCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGEKHSDSSEETDQGKYECVATNSAG
VRYSSPANLYVRGRERRVQPHFYILKMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDL
TPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTA
TSITITWDSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAV
NSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYT
MEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVP
GQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLK
PNTEYAFRLAARSPQGLGAFTPVVRQRTLQSISPKNFKVKMIMKTSVLLSWEFPDNYNSP
TPYKIQYNGLTLDVDGRTTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLN
GKPSVAPKPDADGFIMVYLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEE
LIQDISRLQRRSLRHSRQLEVPRPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYV
LFVLAVLQKSEPTFAASPFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAI
LLYKKNSKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPDSGLRSPLREPG
FHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNR
YANVIAYDHSRVILQPIEGIVGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWE
QRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGS
SEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIV
IDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSL
YAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTR
VCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQF
TDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMR
YEGVVDIFQTVKMLRTQRPAMVQTEVKMGQGGEA
Download sequence
Identical sequences ENSGGOP00000007927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]