SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008143 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008143
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.7e-20
Family 4'-Phosphopantetheinyl transferase SFP 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008143   Gene: ENSGGOG00000008332   Transcript: ENSGGOT00000008369
Sequence length 172
Comment pep:known_by_projection chromosome:gorGor3.1:11:103709736:103716101:1 gene:ENSGGOG00000008332 transcript:ENSGGOT00000008369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQR
LEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRRQDVP
SQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Download sequence
Identical sequences A0A2I2ZMI9
ENSGGOP00000008143 ENSGGOP00000008143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]