SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008217 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008217
Domain Number 1 Region: 158-239
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.31e-17
Family Translation initiation factor IF3, C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 78-148
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000327
Family Translation initiation factor IF3, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008217   Gene: ENSGGOG00000008409   Transcript: ENSGGOT00000008445
Sequence length 278
Comment pep:known_by_projection chromosome:gorGor3.1:13:9261926:9268009:-1 gene:ENSGGOG00000008409 transcript:ENSGGOT00000008445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQSSPIASAPRLSFLIHAKAFSTAED
TQNEGKKTKKNKTAFSNVGRKISQRIIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRN
TSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQ
QWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVL
RALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Download sequence
Identical sequences ENSGGOP00000008217 ENSGGOP00000008217 XP_004054338.1.27298 XP_004054339.1.27298 XP_004054340.1.27298 XP_004054342.1.27298 XP_018895299.1.27298 XP_018895300.1.27298 XP_018895301.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]