SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000008243 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000008243
Domain Number 1 Region: 11-127
Classification Level Classification E-value
Superfamily POZ domain 1.02e-32
Family BTB/POZ domain 0.00027
Further Details:      
 
Domain Number 2 Region: 345-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000258
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000008243   Gene: ENSGGOG00000008438   Transcript: ENSGGOT00000008472
Sequence length 586
Comment pep:known_by_projection chromosome:gorGor3.1:18:45676253:45688598:-1 gene:ENSGGOG00000008438 transcript:ENSGGOT00000008472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGTLASQPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIV
NVCLEIMEPDDDDDTEDFADQENLPDPQDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQA
GSPGHLGVIRDFSIESLLRENLYPKANIPDSRPSLSPFAPDFFPHLWPGDFGAFAQLPEQ
PMDSGPLDLVIKNRKIKEEEKEELPPPPPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGA
YLNFLSATHLGGLFPPWPLVEERKLKPKASQQCPICHKVIMGAGKLPRHMRTHTGEKPYM
CTICEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFC
YKSFTRSDHLHRHIKRQSCRMARPRRGRKPAAWRAASLLFGPSGPAPDKAAFVMPPALGE
VGGHLGGAAVCLPGPSPAKHFLAAPKGALSLQELERQFEETQMKLFGRAQLEAERNAGGL
LAFALAENVAAARPYFPLPDPWAAGLAGLPGLAGLNHVASMSEANN
Download sequence
Identical sequences ENSGGOP00000008243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]